Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS23 | JS99284 | Luxembourg | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDC+ AZT+ SQV | 48 |
| 2 | D4T+ 3TC+ IDV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48GV | L10F, N88T | I15V, K20R, E35D, M36I, R41K, M46X, I62V, L63S, A71V, I72V, L89M, I93L |
| >JS99284| codons 4-99 TLWQRPFVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKXIVGIGGFIKVRQYDQVS IEICGHKVVGTVLVGPTPVNIIGRTMLTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |