<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS21 JS98158 Luxembourg 1994 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 RTV+ AZT+ DDI 48
3 RTV+ 3TC+ D4T 120

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, K70R, M184I, L210W, T215Y A62V     K64R, V118I, D123E, Q197E, E203K, R211K, I244L, S251T F214W, D218H
>JS98158| codons 25-252
PLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVIRKKDSSRWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYIDDLYVGSDLEIGEHRTKIKE
LRQHLWKWGWYTPHKKHQKEPPFLWMGYELHPDKWTVQPLVLPEKDTW

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005