Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS21 | JS97383 | Luxembourg | 1993 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI | NA |
| 2 | RTV+ AZT+ DDI | 48 |
| 3 | RTV+ 3TC+ D4T | 36 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A, L90M | L33F | L10I, I13V, E35D, N37E, L63P, A71T, V77I |
| >JS97383| codons 4-99 TLWQRPIVTVKIGGQLKEALLDTGADDTVFEDMELPGRWKPKMIGGIGGFVKVRQYDQIP IEICGHKTIGTVLIGPTPANIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
