Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS19 | JS98093 | Luxembourg | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC+RTV | 36 |
| 2 | 3TC+D4T+IDV | 24 |
| 3 | 3TC+IDV+SQV | 24 |
| 4 | NVP+3TC+IDV+SQV | 12 |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M184I, T215Y | K103N, Y181C | T39E, M41X, E44D, K122E, S162A, G196E, E203D, H208Y, V245E | Q197F |
| >JS98093| codons 25-252 PLTEEKIKALVEICEEXEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRT QDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRY QYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVICQYIDDLYVGSDLEIEFHRTKIDE LRQYLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSW |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Gonzales, MJ | Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. | AIDS, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
