<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS15 JS98275 Luxembourg 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT+ RTV 24
2 DDC+ AZT+ IDV 12
3 D4T+ 3TC+ IDV 48
4 D4T+ 3TC+ SQV+ IDV 12
5 NVP+ SQV+ AZT+ 3TC 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, E35D, N37S, A71V, I93L  
>JS98275| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIVGIGGFTKVRQYDQIL
IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005