Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS15 | JS98275 | Luxembourg | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI+ AZT+ RTV | 24 |
| 2 | DDC+ AZT+ IDV | 12 |
| 3 | D4T+ 3TC+ IDV | 48 |
| 4 | D4T+ 3TC+ SQV+ IDV | 12 |
| 5 | NVP+ SQV+ AZT+ 3TC | 36 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54T, V82A | L10I, E35D, N37S, A71V, I93L |
| >JS98275| codons 4-99 TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIVGIGGFTKVRQYDQIL IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |