<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS15 JS96319 Luxembourg 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT+ RTV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215Y       E44D, V118I, D123E, S162C, E203D, R211K  
>JS96319| codons 25-252
PLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIDE
LRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSW

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005