Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS14 | JS98119 | Luxembourg | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC | NA |
| 2 | 3TC+AZT+SQV | 24 |
| 3 | AZT+DDI+SQV | 24 |
| 4 | AZT+DDI+RTV | 36 |
| 5 | DLV+D4T | 12 |
| 6 | NVP+D4T+IDV | 28 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, V82A | Q58E | I15V, K20R, E35D, M36I, N37D, R41K, K55N, L63Q, H69Y, I85V, L89M | G51K |
| >JS98119| codons 4-99 TLWQRPLVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKLIGGIKGFVNVREYDQIQ IEICGYKAIGTVLVGPTPANIVGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
