Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS14 | JS97499 | Luxembourg | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC | NA |
| 2 | 3TC+AZT+SQV | 24 |
| 3 | AZT+DDI+SQV | 24 |
| 4 | AZT+DDI+RTV | 36 |
| 5 | DLV+D4T | 12 |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, T69D, L210W, T215Y | Y181C | V35T, I37F, E44D, D123S, S162D, E169D, K173A, Q174K, I178L | I135N |
| >JS97499| codons 25-252 PLTEEKIKALTEFCTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRT QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKSFRKYTAFTIPSNNNETPGIRY QYNVLPQGWKGSPAIFQDSMTKILDPFRAKNPDLVICQYMDDLYVGSDLEIGQHRTKIEE LRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSW |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Gonzales, MJ | Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. | AIDS, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
