<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS11 JS99289 Luxembourg 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 108
2 D4T+ DDI+ IDV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F Q58E L10I, I13V, K20R, E35D, M36I, R57K, L63P, H69K, L89M G49V, Y59E
>JS99289| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVLEDINLPGRWKPKIIGVIGGFVKVKEEDQIP
IEICGKKAIGTVLVGPTPFNIIGRNMLTQIGCTLNF

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005