Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS10 | JS98113 | Luxembourg | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+DDC+RTV | 72 |
| 3 | D4T+DDI+IDV | 12 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, V82A | L10I, K14R, I62V, L63S, C67D, H69K, A71V, V77I, I93L |
| >JS98113| codons 4-99 TLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQVS IEIDGKKVIGTVLIGPTPANIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |