<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS10 JS98113 Luxembourg 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC+RTV 72
3 D4T+DDI+IDV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   L10I, K14R, I62V, L63S, C67D, H69K, A71V, V77I, I93L  
>JS98113| codons 4-99
TLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQVS
IEIDGKKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005