<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS9 JS98413 Luxembourg 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+SQV 16
2 3TC+DDI+RTV 8
3 3TC+D4T+IDV 12
4 DDC+SQV 24
5 IDV+SQV 32
6 NVP 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184V, L210W, T215Y   Y181C   K122E, I135M, E169D, R211K F214K
>JS98413| codons 25-252
PLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSMNNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEE
LRQHLWKWGKYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSW

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005