Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS9 | JS98148 | Luxembourg | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+SQV | 16 |
| 2 | 3TC+DDI+RTV | 8 |
| 3 | 3TC+D4T+IDV | 12 |
| 4 | DDC+SQV | 24 |
| 5 | IDV+SQV | 32 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A, L90M | L10I, T12V, K20R, E35D, M36I, N37D, R41K, I62V, L63P, A71V, I72V, V77I, I93L |
| >JS98148| codons 4-99 TLWQRPIVVIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVRQYDQVP IEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |