<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS9 JS98148 Luxembourg 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+SQV 16
2 3TC+DDI+RTV 8
3 3TC+D4T+IDV 12
4 DDC+SQV 24
5 IDV+SQV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, T12V, K20R, E35D, M36I, N37D, R41K, I62V, L63P, A71V, I72V, V77I, I93L  
>JS98148| codons 4-99
TLWQRPIVVIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005