<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS9 JS96386 Luxembourg 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+SQV 16
2 3TC+DDI+RTV 8
3 3TC+D4T+IDV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       E44D, V118I, K122E, I135M, E169D F214K
>JS96386| codons 25-252
PLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSMNNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEE
LRQHLWRWGKYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSW

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005