Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS7 | JS99277 | Luxembourg | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC+IDV | 96 |
| 2 | NVP+3TC+D4T | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L19I, E35D, N37S, T74S, I85V |
| >JS99277| codons 4-99 TLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYDQIL IEICGHKAIGSVLVGPTPVNIVGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |