Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS7 | JS97372 | Luxembourg | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC+IDV | 60 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L10I, L19I, A22V, E35D, N37S, I85V |
| >JS97372| codons 4-99 TLWQRPIVTIKIGGQIKEVLLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYDQIL IEICGHKAIGTVLVGPTPVNIVGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |