Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS6 | JS99293 | Luxembourg | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI+ AZT+ RTV | NA |
| 2 | DDC+ AZT+ RTV | 120 |
| 3 | 3TC+ IDV+ D4T | 60 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A, L90M | Q58E | L10I, I15V, K20R, E35D, M36I, N37D, R41K, I62V, L63P, A71T, I93L |
| >JS99293| codons 4-99 TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVREYDQVP IEICGHKTIGTVLVGPTPANIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |