<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS6 JS99293 Luxembourg 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT+ RTV NA
2 DDC+ AZT+ RTV 120
3 3TC+ IDV+ D4T 60

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E L10I, I15V, K20R, E35D, M36I, N37D, R41K, I62V, L63P, A71T, I93L  
>JS99293| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVREYDQVP
IEICGHKTIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005