Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS6 | JS98371 | Luxembourg | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI+ AZT+ RTV | NA |
| 2 | DDC+ AZT+ RTV | 120 |
| 3 | 3TC+ IDV+ D4T | 12 |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, K70R, M184V, L210W, T215Y | K219N | V111I, I135T, S163C, D177E, I178M, E194G, G196E, T200I, H208Y, R211K, V245T |
| >JS98371| codons 25-252 PLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRT QDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRY QYNVLPQGWKGSPAIFQSCMTKILEPFRKQNPEMVIYQYVDDLYVGSDLGIEQHRIKIEE LRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWTVQPITLPEKDSW |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Gonzales, MJ | Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. | AIDS, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |