Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS2 | JS97435 | Luxembourg | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | RTV+SQV | 96 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54V, V82A, I84V | L10I, E35D, M36V, N37D, D60E, Q61E, I62V, L63P, A71V, V77I, I93L |
| >JS97435| codons 4-99 TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIVGIGGFVKVRQYEEVP IEICGHKVIGTVLIGPTPANVIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |