<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q, N348I     V21I, V35M, D123E, D177E, R211K, K277R, T286A, E297A, S322T, I326V, A360T, A376S, K390R  
>173622| codons 1-400
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRGT
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M G73S L10V, N37S, I62V, L63P, I66L, G68E, H69Y, V77I, I93L A71V_KV
>173622| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKLIGGIGGFIKVRQYD
QVPIELCEYKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012