<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_SOU AS_SOU France 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13A, K20I, M36I, R41K, K43R, H69K, L89M  
>AS_SOU| codons 1-99
PQITLWQRPLVKAKIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90I, D121H, K122E, I142T, F171Y, D177E, I178M, Q207A, R211K  
>AS_SOU| codons 40-219
EMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAI
FQSSMTKILEPYRKQNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDK

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000