<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_PET AS_PET France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|DDI|IDV|RTV|SQV|Unknown NA
2 EFV+3TC+ABC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, T215F   L100I, K103N   E53D, V60I, K70X, V90I, K102Q, K122E, D123E, S162Y, G196E, E203K, Q207E  
>AS_PET| codons 40-218
ELEKEGKISKIGPDNPYNTPIFAIKKKNSDXWRKVVDFRELNKRTQDFWEIQLGIPHPAG
IKQNKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELREHLLRWGFFTPD

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005