<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_NZI AS_NZI France 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19F, E35D, M36I, R41K, L63P, H69K, K70R, V77I, L89M  
>AS_NZI| codons 1-99
PQITLWQRPLVTVKIGGQFKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000