<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_MWA AS_MWA France 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, K49R, V60I, A98S, K122E, I135R, S162A, D177E, Q207E  
>AS_MWA| codons 40-220
EMEKEGKITRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSG
LKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAI
FQASMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDK
K

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36I, R41K, L63P, H69Q  
>AS_MWA| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000