<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M A62V, V75I, F77L K103N, Y181YC, G190A   K20R, T39TP, K46KQ, T58N, S68R, V111I, K122E, D123E, I135T, S162C, R172RK, R211I, F214L, A272P, I293V, E300ED, V317A, Q334L, M357A F116N
>165701| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICPEMEKEGQISKIGPENPYNNPV
FVIKRKDRTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDIGDAFNSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFKKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLIWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAD
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARARGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54MV, V82ACGS, I84IV, L90M L10LF, K43T, G73GISV, T74TP, L89LAPV I13IV, I15V, L19Q, K20I, E34ED, E35EG, M36MI, I62IV, L63P, H69HY, A71V, I72L, V77I, I93L  
>165701| codons 1-99
PQITLWQRPFVTVKVGGQQIEALLDTGADDTVLDGINLPGRWTPKIIGGIGGFVKVRQYD
QVPIEICGYKVLVPVLIGPTPSNVIGRNVMTQLGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012