<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_FIA AS_FIA France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       E44D, I135T, S162C, V179G, R199*, T200A F214V
>AS_FIA| codons 40-220
ELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAI
FQCSMTKILEPFRKQNPDIGIYQYMDDLYVGSDLEIGQH*AKIEELRQHLWRWGVYTPDK
K

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, N37S, K43R, L63P, H69Q, V77I  
>AS_FIA| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWRPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005