<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_FAN AS_FAN France 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L89V L10I, I13V, L19P, K20I, M36I, N37S, R41K, L63P, H69K, K70R, A71V, I72M  
>AS_FAN| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRVMGTVLVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y       V60I, V118I, K122E, I135V, T139K, S162A, K166E, E169K, K173T, Q174A, D177E, I178M, T200A, E203K, Q207E, H208Y, R211K  
>AS_FAN| codons 40-220
ELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNEKPGIRYQYNVLPQGWKGSPAI
FQASMTEILKPFRTANPEMVIYQYVDDLYVGSDLEIGQHRAKIKELREYLLKWGFYTPDK
K

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000