<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
160145 160145 Argentina 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       E6EK, K43KE, S68G, K122E, I135V, E138A, V179I, G196R, T200D, R211K, V245E, E248D, T286A, V317A, L325I, I326IV, I329V, M357T, A371V, A376AS, A400T W24W*
>160145| codons 1-400
PISPIKTVPVKLKPGMDGPKVKQ*PLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIRQHRDKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDIVAEVQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKISTESIVIWGKTPKFKLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S K20R, E21Q, E34EK, E35D, M36I, N37NK, R41K, I62V, L63P, H69R, A71I, I72M, V82I, I93L  
>160145| codons 1-99
PQITLWQRPLVTIKIGGQLRQALLDTGADDTVLKDIKLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGRKIMSTVLVGPTPINVIGRNLMTQLGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012