<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS_CHO AS_CHO France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, E35D, N37E, R57K, I62V, L63A  
>AS_CHO| codons 1-99
PQITLWQRPLVIIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVKQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K122E, I135T, G196E, E203D  
>AS_CHO| codons 40-220
ELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIDELRQHLLRWGFYTPDK
K

References
Author Title Citation
Si-Mohamed, A Selection of drug-resistant variants in the female genital tract of human immunodeficiency virus type 1-infected women receiving antiretroviral therapy. J Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005