<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215FY N348I Y188L   K20R, A33G, V35I, T39TA, K102M, V118VI, I142T, K166R, F171Y, K173E, Q174R, G196E, T200R, R211K, A272P, K277R, T286A, V292I, E297K, V317A, G333E, G335CS, M357T, K366R, T386I  
>157709| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKGLIEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPYRERNPDIVI
YQYMDDLLVGSDLEIEQHRRKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQEQSQWTYQIYQEPFKILKTGKYARTRGA
HTNDVRQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L33F, K43KT L10I, I15IV, K20R, E35D, M36I, N37D, R41K, K55R, R57K, Q61N, I62V, L63T, H69Y, I72T, L89M, I93L  
>157709| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVFEDIDLPGKWTPKIIGGIGGFVRVKQYD
NVTIEICGYKATGTVVVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012