<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I47V, I54M, L76V, I84V, L90M L10F, G48E, F53L, L89LV Q7R, I15V, Q18H, L19V, K20I, E34K, E35D, M36I, K55KR, I62V, L63P, A71I, V77I, I85V  
>151524| codons 1-99
PQITLWRRPFVTIKVGGHVIEALLDTGADDTVLKDINLPGRWKPKLVEGIGGLMRVRQYD
QVPIEICGHKIIGTVVIGPTPVNVVGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75M, K219N L100I, K103N   M16V, V21I, E28K, K32E, K43E, E44A, K73M, D86DN, K102R, V118I, K122E, A158S, V179I, H208Y, R211K, L228H, V292I, I293V, E297K, S322T, G335C, G359S, A371V, A376S, K390R, K395KN E396E*
>151524| codons 1-398
PISPIETVPVKLKPGVDGPKIKQWPLTKEKIEALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRMLMDFRELNKRTQNFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQCQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKISTESIVIWGKTPKFRLPIQN*TW

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012