<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
151205 151205 Argentina 2004 HIV1 CRF12_BF Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M L33LF, N88D I13V, I15V, K20R, E35D, M36I, R41K, R57K, Q61D, A71AT, I93L  
>151205| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADNTVFEDINLPGKWKPKMIGGIGGFIKVKQYD
DILIEICGHKTIGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, Y115YF, M184V N348I     V35T, I50IT, D123E, I135V, E169EK, I178L, V179I, I195IK, T200S, D237N, A272P, K277R, K281R, T286A, E297K, Q336QHR, A376T, K390R, Q394L, A400T K49I, D113DN, K353K*, A360AG, W398W*
>151205| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISITGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGNAFFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFRKQNPDLII
YQYVDDLYVGSDLEKGQHRSKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGRWTYQIYQEPFKILKTG*YARMRGG
HTNDVKQLTEAVQKITTESIVIWGKTPKFRLPILKET*ET

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012