Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS97251 | JS97251 | Luxembourg | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M36L, R41K, R57K, L63P, A71T, V77I, I93L |
| >JS97251| codons 1-99 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVKQYD QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Variant human immunodeficiency virus type 1 proteases and response to combination therapy including a protease inhibitor. | AAC, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |