<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
147847 147847 Argentina 2004 HIV1 CRF12_BF Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10LI, T12K, I15V, L19Q, E35D, M36I, R41K, K45KR, K55KR, R57K, Q61N, I62IV, I93L  
>147847| codons 1-99
PQITLWQRPIVKIKVGGQQKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIRVKQYD
NVLIEICGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215I, K219E L100I, K103N   K11R, M16V, V35IL, E53EG, S68G, K122E, I135C, T139TA, T200K, E203ED, K238KI, A272P, T286A, E297K, D320DG, K366KR, Q394L, K395R E29EK, R72I, Q91Q*, Q145QP, W239WR
>147847| codons 1-398
PISPIETVPVRLKPGVDGPKVKQWPLTEKKIKALLEICTEMEKEGKISKIGPGNPYNTPV
FAIKKKNGTKWIKLVDFRELNKRTQDFWEV*LGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSCNNEAPGIRYPYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRKKIDELRQHLLRWGFITPDEKHQKEPPFLWMGYELHPDIRT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYGPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPILRETW

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012