<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
147705 147705 Argentina 2004 HIV1 B + F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53FL L10I, K20R, E35D, M36I, N37ND, R41K, R57K, Q61N, L63A, A71V, L89M, I93L  
>147705| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKLIGGIGGLVKVKQYD
NIAIEICGHKVIGTVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, T215Y   K103N A98GR E6D, E44D, W88C, L100LV, V118I, D123E, I178M, V179I, V189I, T200A, E203D, Q207E, H208Y, L210Y, A272P, K281R, T286A, E297K, K311KR, Q334L, M357T, R358K, A376T, T386I, A400T W24W*, N54I, P217PQ, W239WG, L295LQ
>147705| codons 1-400
PISPIDTVPVKLKPGMDGPKVKQ*PLTEEKIKALVEICTELEKDGKISKIGPEIPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFCEVQLGIPHPRGVKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLYIGSDLEIGQHRAKIDELREYLYRWGFYTQDKKHQKEPPFLWMGYELHPDKGT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPQTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKITTESIVIWGKIPKFKLPIQKETWET

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012