<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
146098 146098 Argentina 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48Q, I54V, V82A L24I, F53L L10V, T12N, G16E, L19I, K20R, M36L, N37D, R41K, L63P, I64V  
>146098| codons 1-99
PQITLWQRPVVNIKIEGQIREALIDTGADDTVLEELDLPGKWKPKLIQGIGGLVKVRQYD
QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y   K103S, G190A   K20R, E44D, V60I, V118VI, D121DE, K122E, I135T, E169D, V179I, T200A, I202V, V245KM, K277R, A288S, I293V, E297V, R358K, G359GS, A371V, A376S, T386I, K390R, A400T W24W*, P25PT, F130FI, N136NK, W153WR
>146098| codons 1-400
PISPIETVPVKLKPGMDGPRVKQ*TLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSIPL
EEDFRKYTAITIPSTKNETPGIRYQYNVLPQGRKGSPAIFQSSMTKILDPFRKQNPDIII
YQYMDDLYVASDLEIGQHRAKVEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTVEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKQLTEVVQKISTESIVIWGKIPKFRLPIQKETWET

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012