<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
919_1 919_1 Poland 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, G70E, L101I, T112V, S119R, T124N, K160Q, R187K, V201I, T206S, S230N, D256E S283G
>919_1| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEEKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGRN
FTSNTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKQIIGQVRDQAEHLKTAVQMAV
FIHNFKKKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Parczewski, M HIV-1 integrase resistance among antiretroviral treatment naive and experienced patients from northwestern Poland. BMC Infect Dis, 2012