<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
573_2 573_2 Poland 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97TA S17N, I72V, L101V, T112I, T125A, E157Q, K160Q, V201I, K211Q, I217V, S230N, L234I, A265V  
>573_2| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFVLKLAGRWPVKIIHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTQELQKQVTKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Parczewski, M HIV-1 integrase resistance among antiretroviral treatment naive and experienced patients from northwestern Poland. BMC Infect Dis, 2012