<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
502_17 502_17 Poland 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, L101I, S119P, T122I, T125A, G163E, H171L, I182V, T218S, I220L, Q221H, N222A A8AT, G47GR
>502_17| codons 1-288
FLDGIDKTQEDHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKREAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FISTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAELLKTAVQMAV
FVHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQISKLHAFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Parczewski, M HIV-1 integrase resistance among antiretroviral treatment naive and experienced patients from northwestern Poland. BMC Infect Dis, 2012