<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
235_1 235_1 Poland 1999 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14KR, L28LI, P30S, L101I, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218TS, Y227F, L234I, S255N, D256E S283G
>235_1| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNIPSVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQISKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Parczewski, M HIV-1 integrase resistance among antiretroviral treatment naive and experienced patients from northwestern Poland. BMC Infect Dis, 2012