<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
894_1 894_1 Poland 2010 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11ED, D41DN, M50L, C56S, I60V, I72V, K111KR, T112V, I113IV, T124A, R187RK, V201I, I203M, T218I, Y227YN, L234I, S255SG, D256E K188KT, R262RS
>894_1| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIVASCNKCQLKGEALHGQVDSSPGV
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVRVVHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKKTGGIGGYSAGERIIDMIATDIQTKELQKQIIKIQNFRVYNRDSRDPIWKGPAK
LLWKGEGAVVIQDNGEIKVVPSRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Parczewski, M HIV-1 integrase resistance among antiretroviral treatment naive and experienced patients from northwestern Poland. BMC Infect Dis, 2012