Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| HW7 | HW7_1 | Germany | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+DDC | NA |
| 3 | aAPA+3TC+AZT+DDC | NA |
| 4 | aAPA+3TC+AZT+RTV | NA |
| 5 | aAPA+3TC+AZT+IDV | NA |
| 6 | aAPA+3TC+D4T+DDI+IDV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, V82A | L10I, I15V, R41K, Q61X, I62M, L63T, H69Y, I72T, I93L |
| >HW7_1| codons 1-99 PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVRQYD XMTIEICGYKATGTVLVGPTPANIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Walter, H | Phenotypic HIV-1 resistance correlates with treatment outcome of nelfinavir salvage therapy. | Antivir Ther, 2000 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |