Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| HW6 | HW6_2 | Germany | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+AZT+IDV | NA |
| 2 | NVP+3TC+D4T+DDI | NA |
| 3 | 3TC+D4T+DDI+NFV+SQV | 16 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I13V, N37S, L63T, E65X, V77I, L89M |
| >HW6_2| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD QITIXICGHKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Walter, H | Phenotypic HIV-1 resistance correlates with treatment outcome of nelfinavir salvage therapy. | Antivir Ther, 2000 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |