<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HW6 HW6_1 Germany 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV NA
2 NVP+3TC+D4T+DDI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, N37C, I62V, L63S, I64M  
>HW6_1| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QVSMEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Walter, H Phenotypic HIV-1 resistance correlates with treatment outcome of nelfinavir salvage therapy. Antivir Ther, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005