Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| HW5 | HW5_2 | Germany | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+DDC | NA |
| 3 | aAPA+3TC+AZT+DDC | NA |
| 4 | aAPA+3TC+AZT+DDI | NA |
| 5 | aAPA+3TC+AZT+RTV | NA |
| 6 | aAPA+3TC+AZT+IDV | NA |
| 7 | aAPA+3TC+D4T+DDI+IDV | NA |
| 8 | aAPA+3TC+AZT+IDV | NA |
| 9 | aAPA+3TC+D4T+NFV | 12 |
| 10 | aAPA+3TC+D4T+NFV+SQV | 16 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A | L24I, F53L | I15V, E35D, M36I, N37D, R41K, L63P, A71T | R87K |
| >HW5_2| codons 1-99 PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDIDLPGKWKPKMIGGIGGLVKVRQYD QIPIEICGHKTIGTVLVGPTPANIIGKNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Walter, H | Phenotypic HIV-1 resistance correlates with treatment outcome of nelfinavir salvage therapy. | Antivir Ther, 2000 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |