<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HW5 HW5_1 Germany 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC NA
3 aAPA+3TC+AZT+DDC NA
4 aAPA+3TC+AZT+DDI NA
5 aAPA+3TC+AZT+RTV NA
6 aAPA+3TC+AZT+IDV NA
7 aAPA+3TC+D4T+DDI+IDV NA
8 aAPA+3TC+AZT+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I I15V, E35D, N37E, R41K, I62V, L63P, A71T  
>HW5_1| codons 1-99
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMELPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Walter, H Phenotypic HIV-1 resistance correlates with treatment outcome of nelfinavir salvage therapy. Antivir Ther, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005