<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HW3 HW3_2 Germany 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC NA
3 3TC+AZT+SQV NA
4 D4T+DDI NA
5 D4T+DDI+IDV NA
6 3TC+DDI+IDV NA
7 3TC+AZT+NFV+SQV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, L63P, H69N, A71V, V77I, L89X  
>HW3_2| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGNKVIGTVLIGPTPANIIGRNXLTQIGCTLNF

References
Author Title Citation
Walter, H Phenotypic HIV-1 resistance correlates with treatment outcome of nelfinavir salvage therapy. Antivir Ther, 2000
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005