<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+DDI 4
2 ABC+EFV+NFV+RTV+SQV 4
3 EFV+NFV+RTV+SQV 31
4 None 26
5 3TC+DDI+LPV+SQV 39
6 3TC+APV+DDI+EFV+LPV+T20 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75I, F77L, F116Y K103N, Y181C, G190A   K20R, T39A, S68G, T69X, K70X, K101R, D123E, I135T, S163I, I167V, D177E, T200A, I202V, R211K E194E*
>36708-3| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FVIKKKDGXXWRKLIDLRELNKRTQDFWEVQLGIPHPAGLRKNKSVTVLDVGDAFYSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSIMTKVLEPFRKQNPEIVI
CQYVDDLYVASDL*IGQHRAKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDS

References
Author Title Citation
Villena, C Relative fitness and replication capacity of a multinucleoside analogue-resistant clinical human immunodeficiency virus type 1 isolate with a deletion of codon 69 in the reverse transcriptase coding region. J Virol, 2007