<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+DDI 4
2 ABC+EFV+NFV+RTV+SQV 4
3 EFV+NFV+RTV+SQV 31
4 None 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Y115F, Q151M, M184MV A62V, V75I, F77L, F116Y K103N, Y181C, G190A   T39A, S68G, T69A, K101R, D123E, I135T, I167V, D177E, I202V, R211K W71W*
>36708-2| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFVIKKKDGAG*RKLIDLRELNKRTQDFWEVQLGIPHP
AGLRKNKSVTVLDVGDAFYSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKVLEPFRKQNPEIVICQYVDDLYVASDLEIGQHRTKVEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Villena, C Relative fitness and replication capacity of a multinucleoside analogue-resistant clinical human immunodeficiency virus type 1 isolate with a deletion of codon 69 in the reverse transcriptase coding region. J Virol, 2007