<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+DDI 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Y115F, Q151M, M184V A62V, V75I, F77L, F116Y Y181C   K20R, T39A, S68G, T69A, K101R, D123E, I135T, I167V, D177E, I202V, R211K, I293V, P294T, E297K, I375V, T386I, V435I, E449D, D460N, S468P, L491S, K512T, L517I, S519N  
>36708-1| codons 1-523
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FVIKKKDGAGWRKLIDLRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAFYSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKVLEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVTLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKVATESIVIWGKIPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRDTKLGKAGYVTNRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDTSESEIVNQIIE

References
Author Title Citation
Villena, C Relative fitness and replication capacity of a multinucleoside analogue-resistant clinical human immunodeficiency virus type 1 isolate with a deletion of codon 69 in the reverse transcriptase coding region. J Virol, 2007