<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VN-55 VN-55 Vietnam 2005 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20R, E35D, M36I, R41K, H69K, L89M, I93V  
>VN-55| codons 1-99
PQITLWQRPIVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D E6D, K11T, E28K, K32E, V35T, T39K, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, T200I, Q207N, R211S, V245E  
>VN-55| codons 1-250
PISPIDTVPVTLKPGMDGPKVKQWPLTKEKIEALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMDI
YQYMDDLYVGSDLEIGQHRIKIEELRNHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKD

References
Author Title Citation
Trinh, QD Short communication: Drug resistance mutations in the HIV type 1 protease and reverse transcriptase genes in antiretroviral-naive Vietnamese children. ARHR, 2012